Top quality 99% Teriparatide acetate Teriparatide powder fast and safe delivery CAS NO.52232-67-4

Teriparatide is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis.It is also occasionally used off-label to speed fracture healing. Teriparatide is identical to a portion of human parathyroid hormone (PTH) and intermittent use activates osteoblasts more than osteoclasts, which leads to an overall increase in bone.

Name:Teriparatide Acetate, Teriparatida , Teriparatidum

Cas No: 52232-67-4(net),99294-94-7(acetate)

Formula: C181H291N55O51S2

Molecular: 4117.71

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Purity:98%

Appearance: white powder

Source: synthetic

Function:

Teriparatide is the only anabolic (i.e., bone growing) agent indicated for use in postmenopausal women with osteoporosis at a high risk for fracture or with a history of osteoporotic fracture, patients with multiple risk factors for fracture, and for patients who have failed or are intolerant to other available osteoporosis therapy. It has been FDA-approved since 2002. It is effective in growing bone (e.g., 8% increase in bone density in the spine after one year) and reducing the risk of fragility fractures. Osteoporosis medications are generally safe, but some side effects of teriparatide include headache, nausea, dizziness, and limb pain. 

Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers.

Our advantages:

1, High quality with competitive price:
1) Standard:BP/USP/EP/Enterprise standard
2) All Purity≥99%
4) We are manufacture

Shaanxi Mingqi chemical CO., ltd is committed to the development of import and export trade in the production, operation and plant extracts of pharmaceutical raw materials and intermediates. It has trade with other Asian countries and Europe, the Americas and African countries. Important exporters of pharmaceutical chemical raw materials and the world's latest importers of pharmaceutical raw materials.

Shaanxi Mingqi chemical CO., ltd has always been adhering to the company to market-oriented, customer-centric, with professional and enterprising team spirit and the company's strong financial strength, to provide customers with fast, high quality and efficient services, and always " To benefit customers "for the purpose.

In the pharmaceutical raw materials and intermediates export business, the company by virtue of years of accumulated experience and high quality and reasonable talent structure, accurate grasp of the market, not only with a number of well-known domestic production enterprises to establish a long-term stable strategic cooperative relations in the global pharmaceutical chemical raw materials And chemical intermediates on the market also won the loyal customer base and a very strong strategic partner, set up a professional image of the outsourcing of pharmaceutical procurement. On the basis of continuing to develop the existing export trade business, the Company has formulated the idea of establishing independent research and development center and constructing the production base of pharmaceutical and chemical products according to the future development trend of the pharmaceutical and chemical industry, and strives to establish the combination of R & D, manufacturing and trade Of the business development model.

While actively expanding their business and creating economic profits, enterprises do not forget their social responsibility, and actively participate in greening trees, poor students and other social activities, and become a tradition for many years, creating a good social benefits.